DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG18179

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:246 Identity:64/246 - (26%)
Similarity:109/246 - (44%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMA--LIKT---NDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVT 95
            :||.|..|.|.|.|::.  ||:|   |...:..|::|.:.::||||||:.||      |.:    
  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTD------YVE---- 93

  Fly    96 LGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQL 160
              :::....|.:....:....:....|.::..:..| ||.|:| ..|:.:...|..:.:   ...
  Fly    94 --IHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGR-DIGLIR-TPSVGFTDLINKVAL---PSF 151

  Fly   161 KPQTDLIQE--FTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDT 223
            ..::|...:  ..|.|||...||.:::.||.:.:..|....||.::.......| |.....|:.:
  Fly   152 SEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDM-CTRRTDGKSS 215

  Fly   224 CKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCR----GFGMYTDVMGHI 270
            |..||||||..|      ..|..:|:::.|:.||.    |:...||.:|.|
  Fly   216 CGGDSGGPLVTH------DNARLVGVITFGSVDCHSGPSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 64/246 (26%)
Tryp_SPc 37..276 CDD:238113 64/245 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 63/244 (26%)
Tryp_SPc 40..263 CDD:238113 64/245 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.