DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG8329

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:277 Identity:76/277 - (27%)
Similarity:114/277 - (41%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIPK--IVGGVDAGELKNPWMALIKTNDEFICGGSVIT 68
            ::||...:.|.|...|......|      ||  ||.|..|.|.|.|:...::.|:..:.|||||.
  Fly     8 LLLFVATVCAHRNRNRTAHHGGG------PKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIG 66

  Fly    69 NKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRND 133
            |.:|||||||:.||        .:|:..| .:....|:..|   ..|....:.|..:. .:..:|
  Fly    67 NNWVLTAAHCLTTD--------SVTIHYG-SNRAWNGQLQH---TVNKNNFFRHPGYP-NSAGHD 118

  Fly   134 IALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQE------FTAIGWGVTGNGKMSNNLQMVKI 192
            |.|:|       .|.:. ...|:|....|:.....|      ..|.|||...||.:::.||.:.:
  Fly   119 IGLIR-------TPYVS-FTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDV 175

  Fly   193 YRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDC 257
            ..|....|..::.......| |.....|:..|..||||.|..|      ....|:|:::..:..|
  Fly   176 QVISNGECARSYGSVASTDM-CTRATDGKSVCGGDSGGALVTH------DNPIQVGVITFASIGC 233

  Fly   258 R-GFGMYTDVMGHIDFI 273
            : |...||.|..|:|:|
  Fly   234 KSGPSGYTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 68/245 (28%)
Tryp_SPc 37..276 CDD:238113 68/244 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 68/244 (28%)
Tryp_SPc 35..250 CDD:214473 67/242 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.