DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:71/250 - (28%)
Similarity:104/250 - (41%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYH 100
            :|..|..|.|.|.|:...:..:..:.||||:|:|::||||.||:..|        .:||..|   
  Fly    36 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGGD--------AVTVYFG--- 89

  Fly   101 LLATGEHN--HPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQ 163
              ||...|  ..|        ::.....|.:...||||:|:       |.:....::...:|...
  Fly    90 --ATWRTNAQFTH--------WVGSGNFITHGSADIALIRI-------PHVDFWHMVNKVELPSY 137

  Fly   164 TDLIQEF-----TAIGWGVTGNGK-MSNNLQMVKIYRIDRKMCEAAFWY---TFDYPMFCAGTAV 219
            .|...::     .|.|||.|.:|. :.:.||.|.:..|....|  |.:|   |....:.|.....
  Fly   138 NDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC--ASYYGTGTVGDNIICVRVVD 200

  Fly   220 GRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS-TGTEDCRGFGMYTDVMGHIDFI 273
            |:.||..||||||..|   ||.|.......|| .|.:.....| :..|..|:|:|
  Fly   201 GKGTCGGDSGGPLVTH---DGSKLVGVTNWVSGAGCQAGHPAG-FQRVTYHLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 70/248 (28%)
Tryp_SPc 37..276 CDD:238113 70/248 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 70/248 (28%)
Tryp_SPc 37..254 CDD:238113 70/248 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.