DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG33460

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:283 Identity:76/283 - (26%)
Similarity:123/283 - (43%) Gaps:50/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLFAWMLT--AGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITN 69
            :|.::||.  :...||..|.|.||:..:.....:|         ||.||:.|:....|.|::||:
  Fly     9 LLASYMLVIYSDSVSANYLYEQCGLMREEFSTSLG---------PWTALLHTDGSIFCAGTLITD 64

  Fly    70 KFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEI--------YNVERVYIHDSFA 126
            .|:||||.|        ::...:.|.||.:       ..:|:|:        :.:.|::.::|.|
  Fly    65 VFILTAASC--------IRPNAVKVRLGEF-------GRYPNELPEDHLVHYFLMYRLFNNESLA 114

  Fly   127 IQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIG--WGVTGNGKMSNNLQM 189
                 |:|.||:|.|.:.....|.|:||:||    ||...:.....||  |....|..::..|:.
  Fly   115 -----NNIGLLKLTKRVQITDYIMPVCIVLN----PQNQQLSTMRFIGNAWMEDSNVSLTKELRP 170

  Fly   190 VKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGT 254
            : :.:...|||.....||    .||||......:|...:|..|..:..:....|..|.||.:...
  Fly   171 I-VIQSKPKMCTNLDLYT----QFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVND 230

  Fly   255 EDCRGFGMYTDVMGHIDFIERIV 277
            .||.....||||:....:|:.:|
  Fly   231 MDCEESQGYTDVLKFYWWIQDVV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 65/246 (26%)
Tryp_SPc 37..276 CDD:238113 66/248 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 65/236 (28%)
Tryp_SPc 44..249 CDD:214473 64/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.