DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG10469

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:112/265 - (42%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGV--DAGELKNPWMALIKTNDEFICGGSVIT 68
            :|.|:.:.....||.|:::.......|| |..||.:  ..|....|.|          |||::::
  Fly     8 IVQFSLVFGQETGSLRIMNGTAAKAKQL-PYQVGLLCYFEGSKDEPNM----------CGGTILS 61

  Fly    69 NKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRND 133
            |::::|||||:...:..:.|.        :.|:......:....:.|.....:|..|..:...||
  Fly    62 NRWIITAAHCLQDPKSNLWKV--------LIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTND 118

  Fly   134 IALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRK 198
            |||::|.|.:.:...|:|  ..|....|..|.  ::....|||:|.....|..||.::...|..|
  Fly   119 IALIKLPKKLTFNKYIQP--AKLPSAKKTYTG--RKAIISGWGLTTKQLPSQVLQYIRAPIISNK 179

  Fly   199 MCEAAFW---------YTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGT 254
            .||.. |         ........|..:..|. .|:.|||||:   :|.||.:  |.:||||.|.
  Fly   180 ECERQ-WNKQLGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPM---VLDDGSR--TLVGIVSHGF 237

  Fly   255 E-DCR 258
            : :|:
  Fly   238 DGECK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 61/235 (26%)
Tryp_SPc 37..276 CDD:238113 61/234 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 65/250 (26%)
Tryp_SPc 24..260 CDD:238113 64/249 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.