DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG10472

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:308 Identity:82/308 - (26%)
Similarity:137/308 - (44%) Gaps:70/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AWVVLFAWMLTAGR---GSARLLDEDCGVPM---QLIPKIVGGVDAGELKNP-------WMALIK 55
            |.|:|.|.:|.|..   .|.:.|:.:..:|.   :.:|.  |.:..|::..|       .:.|..
  Fly     6 ATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPS--GRITGGQIAEPNQFPYQVGLLLYI 68

  Fly    56 TNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPH------EIY 114
            |.....|||::|::::::||||  |||        .||..:.||    .|.|:..:      :|.
  Fly    69 TGGAAWCGGTIISDRWIITAAH--CTD--------SLTTGVDVY----LGAHDRTNAKEEGQQII 119

  Fly   115 NVE--RVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEF-----TA 172
            .||  .|.:|:.:..:...|||:|::|...|.:...|:|.      :|..::|....:     .|
  Fly   120 FVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPA------KLPVKSDSYSTYGGENAIA 178

  Fly   173 IGWGVTGNGKMSNN-------LQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGG 230
            .||     ||:|::       ||...:..::...|...::........|..|..|..||..||||
  Fly   179 SGW-----GKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGG 238

  Fly   231 PLYIHMLFDG---IKRATQLGIVSTGTEDCRGF-GMYTDVMGHIDFIE 274
            ||   :|.||   :..||..|| :.|.|  .|: |::|.:..::|:||
  Fly   239 PL---VLDDGSNTLIGATSFGI-ALGCE--VGWPGVFTRITYYLDWIE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 70/267 (26%)
Tryp_SPc 37..276 CDD:238113 72/269 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 69/263 (26%)
Tryp_SPc 47..282 CDD:238113 71/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.