DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:119/273 - (43%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VPMQLIP-------KIVGGVDAGELKNPWMALIKTND----EFICGGSVITNKFVLTAAHCMCTD 82
            ||::.:|       :|..|..|.|.|.|::..::.::    .:.||||:|.:::|||||||    
  Fly    22 VPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHC---- 82

  Fly    83 EECIVKY--TQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVY 145
                 .|  :.:|::.|.              ::..:..:.|  :...|..|||||:|       
  Fly    83 -----TYGASYVTISYGA--------------VWRQQPQFTH--YDTGNLHNDIALIR------- 119

  Fly   146 KPQIKPLCILLNDQLKPQTDLIQEF-----TAIGWGVTGNGK-MSNNLQMVKIYRIDRKMC---E 201
            .|.:....::...:|....|....|     ...|||.:.:.. |::.|..|.|...|..:|   .
  Fly   120 TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYY 184

  Fly   202 AAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGT-EDC-----RGF 260
            .:.:.|.::  .|..|...:.:|..||||||.:|   ||.:   |:||||.|: ..|     :|.
  Fly   185 GSHYITSNH--LCYATPENKGSCSGDSGGPLVLH---DGNR---QVGIVSFGSAAGCLSNSPKGL 241

  Fly   261 GMYTDVMGHIDFI 273
               |.|.|::|:|
  Fly   242 ---TRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 67/257 (26%)
Tryp_SPc 37..276 CDD:238113 68/258 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 67/257 (26%)
Tryp_SPc 37..254 CDD:238113 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.