DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and yip7

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:290 Identity:73/290 - (25%)
Similarity:124/290 - (42%) Gaps:44/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RAWVVLFAWMLTAGRGSARLLDEDCGV-PMQLI--PKIVG----GVDAGELKNPW---MALIKTN 57
            :.:|||   :|.....||.||.....| |...:  |.|.|    |.||...:.|:   ::...:.
  Fly     2 KVFVVL---VLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSA 63

  Fly    58 DEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIH 122
            ..:.||||:|.|::|||||||           |....::.:|:...........::.:..:...|
  Fly    64 GSWWCGGSIIGNEWVLTAAHC-----------TDGAASVTIYYGATVRTSPEFTQVVSSSKFRQH 117

  Fly   123 DSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAI--GWGVTGN--GKM 183
            :|:.....||||:|:: ..|:.:...:..:.:   ..:.......:..||:  |||:|.:  ..:
  Fly   118 ESYLALTIRNDISLIQ-TSSVSFSATVNKISL---PAVSNSYSTYEGKTAVASGWGLTSDQATAV 178

  Fly   184 SNNLQMVKIYRIDRKMCEAAFW-YTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQL 247
            |.:||.|.:..|....|:..|. ......:.|..|.....||:.||||||.:    ||:    .:
  Fly   179 SRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL----DGV----LI 235

  Fly   248 GIVSTGTED-CRGF--GMYTDVMGHIDFIE 274
            |..|.|:.| |...  ..:|.:..:.|:|:
  Fly   236 GATSFGSADGCESGAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 61/251 (24%)
Tryp_SPc 37..276 CDD:238113 62/253 (25%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 59/247 (24%)
Tryp_SPc 40..267 CDD:238113 60/249 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.