DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG15873

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:369 Identity:74/369 - (20%)
Similarity:134/369 - (36%) Gaps:124/369 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SARLLDEDCGVPMQLIPK-----IVGGV--DAGELKNPWMALIKTN------DEFICGGSVITNK 70
            |..|.|.|.||...:..:     |.||.  .:..|....:::...|      |...|.|.:::::
  Fly    13 STSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSR 77

  Fly    71 FVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNY-RNDI 134
            .|||||||:....:..:....:.|..|....||..:.:   :..:|:|:.:|..:  :.| :||:
  Fly    78 AVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDES---DFRSVDRLVVHPEY--ERYKKNDL 137

  Fly   135 ALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTA----------IGWG-VTGNGKMSNNLQ 188
            |:|||.:.:...          |..:.|   |:...||          :||| :..:|..||.|.
  Fly   138 AILRLSERVQSS----------NHDVLP---LLMRKTANVTYGDTCITLGWGQIYQHGPYSNELV 189

  Fly   189 MVKIYRIDRKMCEAAF-WYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVST 252
            .:.:......:|:..: .:|.|:.: |.........|..|.||||.                   
  Fly   190 YLDVILRPPSLCQKHYDTFTADHNV-CTEPVGESMNCAGDMGGPLL------------------- 234

  Fly   253 GTEDCRG--FGMYTDVMGHIDFIERIVLDADIEVVLPYIDLLDAGCLGNDTLNSWDRSGPDAIRS 315
                |:|  ||:   :.||:                        ||.|.              ::
  Fly   235 ----CKGALFGL---IGGHM------------------------GCAGG--------------KA 254

  Fly   316 FEWLAEVYKDSFIISNGALISKTFVVTTAQLISESTALKVQLGQ 359
            .::|:.:|            .|.:::.|.|.:|: ..::|.|.:
  Fly   255 MKFLSFLY------------YKDWILLTIQSLSD-CGVRVSLSR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 57/264 (22%)
Tryp_SPc 37..276 CDD:238113 57/261 (22%)
Trypsin 310..520 CDD:278516 8/50 (16%)
Tryp_SPc 313..520 CDD:304450 8/47 (17%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/282 (21%)
Tryp_SPc 59..250 CDD:238113 53/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.