DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG30283

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:287 Identity:97/287 - (33%)
Similarity:144/287 - (50%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLFA--WMLTAGRGSARLLDEDCG-VPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVI 67
            |||.|  .::..|..|...|:..|| ||:... ||:||.:|.....||||::.....|.|||::|
  Fly    10 VVLLAASSVVVLGSESGSFLEHPCGTVPISQF-KILGGHNAPVASAPWMAMVMGEGGFHCGGTLI 73

  Fly    68 TNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRN 132
            ||:||||:|||:...|        |.|.|||.      |.....:.:.|:.:::|..:...  ::
  Fly    74 TNRFVLTSAHCIANGE--------LKVRLGVL------EREAEAQKFAVDAMFVHTDYYFD--QH 122

  Fly   133 DIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDR 197
            |:|||||.|.:.|...|.|:|:||:..:|...:.|.:|...|||.|.:...|..||...::.:.|
  Fly   123 DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHR 187

  Fly   198 KMCEAAFWYTFDYP-------MFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTE 255
            ..|..      .||       ..||.:| ..:||..||||||...:.:|.::...|.|:.|.|..
  Fly   188 SECAK------QYPHQQINRNHICAESA-NANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHA 245

  Fly   256 DCRGFGMYTDVMGHIDFIERIVLDADI 282
            ||....::|:||.|:|:|...|..|:|
  Fly   246 DCSKATVFTNVMTHLDWIVNTVRRAEI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 82/243 (34%)
Tryp_SPc 37..276 CDD:238113 82/245 (33%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 82/243 (34%)
Tryp_SPc 43..266 CDD:238113 82/245 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.