DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG1773

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:278 Identity:94/278 - (33%)
Similarity:142/278 - (51%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RLLDEDCGVPMQLIP------KIVGGVDAGELKNPWMALIKTNDEF---ICGGSVITNKFVLTAA 76
            :|..:||||...|||      :|.||..:..|..||||.:..:.:.   .||||:::..||||||
  Fly    40 QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAA 104

  Fly    77 HC--MCTDEECIVKYTQLTVTLGVYHLLATGE---HNH------PHEIYNVERVYIHDSFAIQNY 130
            ||  ||.      :..::.|.||...:.:|.:   :|:      |.|.:.:::..:|:.|.:...
  Fly   105 HCFKMCP------RSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYP 163

  Fly   131 RNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQT-DLIQEFTAIGWGVTGNGKMSNNLQMVKIYR 194
            ..||||::|.|.:|:|..|:|:|:.|.|:|...| .|.|.:.|:|||.|.:.:.:|:...|   .
  Fly   164 GYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEV---H 225

  Fly   195 IDRKMCEAAFWYTFDYPMFCA-GTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCR 258
            |:.:.|...    .|....|| |..|  |||..||||||.......|..|..|.|:||||:::| 
  Fly   226 INTEKCTDG----RDTSFLCANGDYV--DTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNC- 283

  Fly   259 GFGM---YTDVMGHIDFI 273
            |.|.   |.||..::.:|
  Fly   284 GAGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 85/255 (33%)
Tryp_SPc 37..276 CDD:238113 86/256 (34%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 85/255 (33%)
Tryp_SPc 62..301 CDD:238113 85/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.