DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon44E

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:299 Identity:88/299 - (29%)
Similarity:126/299 - (42%) Gaps:72/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLFAWMLTAGRG-----SARLLDEDCGVPMQLIP-------KIVGGVDAGELKNPWMALIKTND- 58
            |..|.:..|..|     |||      .||::.:|       :|..|..|.|.|.|::..:..|| 
  Fly     5 VFLACLAVASAGVVPSESAR------AVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDG 63

  Fly    59 EFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHD 123
            .:.||||:|.:.:|||||||                |....|:|.....:..||.....  ::..
  Fly    64 GYWCGGSIIDHTWVLTAAHC----------------TNSANHVLIYFGASFRHEAQYTH--WVSR 110

  Fly   124 SFAIQN------YRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFT-----AIGWGV 177
            |..||:      ..|||||:|:       |.:....::...:|....|....::     |.|||:
  Fly   111 SDMIQHPDWNDFLNNDIALIRI-------PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGL 168

  Fly   178 TGNGK-MSNNLQMVKIYRIDRKMCEAAFWYTFDY---PMFCAGTAVGRDTCKRDSGGPLYIHMLF 238
            |.|.. |||.|..|.:..||...|..  :|..:|   ...|..|..|:.:|..||||||.:|   
  Fly   169 TDNNSGMSNYLNCVDVQIIDNNDCRN--YYGSNYITDNTICINTDGGKSSCSGDSGGPLVLH--- 228

  Fly   239 DGIKRATQLGIVSTGT-EDC---RGFGMYTDVMGHIDFI 273
               .....:||||.|: |.|   |..| :|.|.|::|:|
  Fly   229 ---DNNRIVGIVSFGSGEGCTAGRPAG-FTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 77/256 (30%)
Tryp_SPc 37..276 CDD:238113 78/257 (30%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 77/256 (30%)
Tryp_SPc 41..266 CDD:238113 78/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.