DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and scaf

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:230 Identity:62/230 - (26%)
Similarity:107/230 - (46%) Gaps:34/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKIVGGVDAGELKNPWMALI--KTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLG 97
            |..|..:||...:.||.|:|  :::...||||::|.::|||::|.|:..     :..|.:.|..|
  Fly   421 PTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNG-----LPVTDIRVKAG 480

  Fly    98 VYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKP 162
            .:.|.:|.| ..|.::..|:.|.:|..:......:|:|::||::.:.:...|:|:||...|   |
  Fly   481 EWELGSTNE-PLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDED---P 541

  Fly   163 QTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRID-----RKMCEAAFWYTFDYPMFCAGTAVGRD 222
            : |..|.||: ||   |...:|.:.:...::..|     |..|.|      |....|:.|..  |
  Fly   542 K-DSEQCFTS-GW---GKQALSIHEEGALMHVTDTLPQARSECSA------DSSSVCSATKF--D 593

  Fly   223 TCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDC 257
            :|:.|.|..|..     |...:.:|..:..|...|
  Fly   594 SCQFDVGSALAC-----GSGSSVRLKGIFAGENSC 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 61/229 (27%)
Tryp_SPc 37..276 CDD:238113 61/228 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 58/214 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.