DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG17572

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:242 Identity:63/242 - (26%)
Similarity:106/242 - (43%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYH-----------LLATGEHNHPHEIYN 115
            |.|:||..:.:||||||.....:   .:...:|.:|.|.           ..|....||.     
  Fly   160 CAGAVIARRVILTAAHCALAKAD---GHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHA----- 216

  Fly   116 VERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLI--QEFTAIGWGVT 178
            :..|.:|..:....|.:|||||.|:..:.|....:|:|:     .|.:.:|:  :..|..||   
  Fly   217 ISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICL-----QKTRANLVVGKRATIAGW--- 273

  Fly   179 GNGKMS-NNLQMVKIYRID-----RKMCEAAFWYT--------FDYPMFCAGTAVGRDTCKRDSG 229
              |||| ::::..::..:|     ..:|...:..|        .:....||| ..|:|.|:...|
  Fly   274 --GKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAG-GEGKDVCQGFGG 335

  Fly   230 GPLYIHMLFDGIKRATQLGIVSTGTEDCRGF---GMYTDVMGHIDFI 273
            .||:|..  :||  .:|:||:|.|:::|.|.   .:||.|....::|
  Fly   336 APLFIQE--NGI--FSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 62/240 (26%)
Tryp_SPc 37..276 CDD:238113 63/242 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 63/242 (26%)
Tryp_SPc 138..378 CDD:214473 62/240 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.