DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:259 Identity:69/259 - (26%)
Similarity:104/259 - (40%) Gaps:53/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMALIKTNDE---FICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLG 97
            :|..|..|.|.|.|::..:..:.:   :.||||:|.:.:|:|||||........:.|..|.....
  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQA 106

  Fly    98 VY-HLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLK 161
            .| |.:.:| |...|..||.           .|..|||       |::..|.:....::...:|.
  Fly   107 QYTHTVGSG-HFRQHSDYNT-----------NNLNNDI-------SLINTPHVDFWHLINKVELP 152

  Fly   162 PQTDLIQEFT-----AIGWG-VTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDY---PMFCAGT 217
            ...:....|.     |.||| ...:..:|:.|..|....|.|..|.:.  |..|.   .:.|..|
  Fly   153 DGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSV--YGTDVITDNVICTST 215

  Fly   218 AVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS--------TGTEDCRGFGMYTDVMGHIDFI 273
            ..|:.||..||||||.:|      .|:..:|:.|        :|..|  ||   |.|..::|:|
  Fly   216 PGGKSTCAGDSGGPLVLH------DRSKLVGVTSFVAASGCTSGLPD--GF---TRVTSYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 68/257 (26%)
Tryp_SPc 37..276 CDD:238113 69/258 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 68/257 (26%)
Tryp_SPc 43..271 CDD:238113 69/258 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.