DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:292 Identity:76/292 - (26%)
Similarity:116/292 - (39%) Gaps:70/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFAWMLTAGRGSARLLDEDCGVPMQLIPK-------IVGGVDAGELKNPWMALIKTNDEFICGGS 65
            :|..:|.....||...||.  |.::.:||       |..|..|.|.|.|:...:..:..:.||||
  Fly     3 VFLAILALAVASASAFDEK--VFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGS 65

  Fly    66 VITNKFVLTAAHCMCTDEECIVKY--------TQLTVTLGVYHLLATGEHNHPHEIYNVERVYIH 122
            :|.:.:||||.||: .|...::.|        .|.|.|:|                        :
  Fly    66 IIAHDWVLTAEHCI-GDAASVIVYFGATWRTNAQFTHTVG------------------------N 105

  Fly   123 DSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEF-----TAIGWGVTGNGK 182
            .:| |::...||||:|:       |.:....::...:|....|....:     .|.|||.|.:|.
  Fly   106 GNF-IKHSNADIALIRI-------PHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGS 162

  Fly   183 -MSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQ 246
             :.:.||.|.:..:..:.|...:....| .:.|..|..|:..|..||||||..|   ||.|....
  Fly   163 PLPDWLQCVDLQIVHNEECGWTYGSVGD-NVICTRTVDGKSICGGDSGGPLVTH---DGSKLVGV 223

  Fly   247 LGIVSTGTEDCR-----GFGMYTDVMGHIDFI 273
            ...||  :..|:     ||...|   .|:|:|
  Fly   224 SNFVS--SNGCQSGAPAGFQRVT---YHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 67/262 (26%)
Tryp_SPc 37..276 CDD:238113 67/256 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 66/255 (26%)
Tryp_SPc 37..253 CDD:238113 67/256 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.