DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG14227

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:288 Identity:87/288 - (30%)
Similarity:134/288 - (46%) Gaps:35/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AWVVLFAWMLTAGR-GSARLLDEDCGVPMQLIPKIV------GGVDAGELKNPWMALIKTNDEFI 61
            |.::|||.:....| |||.|||.:||..:....|:.      ...|.  ..|||:..:..|.:..
  Fly     7 ALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDI--QANPWIVSVIVNGKAK 69

  Fly    62 CGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEH-NHPHEIYN-----VERVY 120
            |.||:|.::||||||||:..:        .:.|.||.:.....|:: :....:.|     :::..
  Fly    70 CSGSLINHRFVLTAAHCVFRE--------AMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKI 126

  Fly   121 IHDSFA-IQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMS 184
            :|..|. ||..:.||.|||:|.::.|...::|:|:|:|:.:.    .|..|....||.|.....|
  Fly   127 VHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVA----AIDRFQLTVWGTTAEDFRS 187

  Fly   185 NNLQMVKIY----RIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRAT 245
              :..|..:    ||||::|...|....|....|..|.... .||.|||||....:|:.|..|..
  Fly   188 --IPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSH-ACKGDSGGPFSAKILYGGTYRTF 249

  Fly   246 QLGIVSTGTEDCRGFGMYTDVMGHIDFI 273
            |.||:..|...|.|..:.|:|..::|:|
  Fly   250 QFGIIIFGLSSCAGLSVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 73/253 (29%)
Tryp_SPc 37..276 CDD:238113 73/254 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 70/234 (30%)
Tryp_SPc 57..277 CDD:238113 70/234 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.