DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and psh

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:281 Identity:90/281 - (32%)
Similarity:128/281 - (45%) Gaps:66/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QLIPKIVGG--VDAGELKNPWMA---LIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQ 91
            ||:..||||  ||.|..  |.||   .|....:|.||||:|.::||||||||:.||..     |.
  Fly   139 QLVIHIVGGYPVDPGVY--PHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDAN-----TP 196

  Fly    92 LTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILL 156
            ..|.||..::   ...:|.::...:..|.||..: :.|..||||:|.|::.:|....|:|.| |.
  Fly   197 AFVRLGAVNI---ENPDHSYQDIVIRSVKIHPQY-VGNKYNDIAILELERDVVETDNIRPAC-LH 256

  Fly   157 NDQLKPQTDLIQEFTAIGWGV--------------------------TGNGKMSNNLQMVKIYRI 195
            .|...|.::  .:|...||||                          ....:...:::::|...|
  Fly   257 TDATDPPSN--SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVI 319

  Fly   196 DRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHML--FDGIKRATQLGIVSTGTEDCR 258
            |..:|      ..|..:..       |.||.|||||| ||.|  .||:  .|.:|::|:|. .|.
  Fly   320 DSLLC------AIDQKLIA-------DACKGDSGGPL-IHELNVEDGM--YTIMGVISSGF-GCA 367

  Fly   259 GF--GMYTDVMGHIDFIERIV 277
            ..  |:||.|..::||||.||
  Fly   368 TVTPGLYTRVSSYLDFIEGIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 83/271 (31%)
Tryp_SPc 37..276 CDD:238113 86/273 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 83/271 (31%)
Tryp_SPc 144..387 CDD:238113 86/273 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.