DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Hayan

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:276 Identity:85/276 - (30%)
Similarity:127/276 - (46%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GVPMQLIPKIVGG--VDAGELKNPWMALIKTND----EFICGGSVITNKFVLTAAHCMCTDEECI 86
            |.|:.:  .|:.|  ||.|..  |.||.|..|.    .|.||||:|.::||||||||:.:|:.  
  Fly   378 GKPLTV--HILDGERVDRGVY--PHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDS-- 436

  Fly    87 VKYTQLTVTLGVYHLLATGEHNHP-HEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIK 150
               |...|.||..::    |:..| ::..||..|.||..::..:...|||:|:|.:.......|:
  Fly   437 ---TPSFVRLGALNI----ENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIR 494

  Fly   151 PLCILLNDQLKPQTDLIQEFTAIGWGVTG--NGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYP-- 211
            |.| |..|:..|..:  .::...||||..  |..:|..|....:..:....|.|:|   .:.|  
  Fly   495 PAC-LYTDRSDPPAN--YKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASF---AEQPSA 553

  Fly   212 -----------MFCAGTAVGR-DTCKRDSGGPLYIHMLFDGIKRATQL-GIVSTGTEDC--RGFG 261
                       ..||.....| |.|:.||||||.:.:  |.:.....: |::|:|. .|  :..|
  Fly   554 NRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEI--DDVDGTYSIVGVISSGF-GCATKTPG 615

  Fly   262 MYTDVMGHIDFIERIV 277
            :||.|...:|:||.||
  Fly   616 LYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 79/262 (30%)
Tryp_SPc 37..276 CDD:238113 81/264 (31%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 79/262 (30%)
Tryp_SPc 385..630 CDD:238113 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.