DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and sphe

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:243 Identity:59/243 - (24%)
Similarity:106/243 - (43%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYH 100
            :|:||.||......:.|.::.::..:||||:::...:||.|||:..|.: ::..::|...:|..:
  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGK-LIDASRLACRVGSTN 88

  Fly   101 LLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTD 165
            ..|.|      :|.|||.|.:|..:  .|..|::|::.|...:.|..:|..:.::.:.:..|...
  Fly    89 QYAGG------KIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEG 145

  Fly   166 LIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGG 230
              .|....|||.|.:|..|..::.:.:.......|..|: ...|...||....:...||..|.||
  Fly   146 --SEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAY-SDHDEQSFCLAHELKEGTCHGDGGG 207

  Fly   231 PLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVM----GHIDFIE 274
                    ..|...|.:|:.:.....|.  ..|.||.    .:.|:|:
  Fly   208 --------GAIYGNTLIGLTNFVVGACG--SRYPDVFVRLSSYADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 58/240 (24%)
Tryp_SPc 37..276 CDD:238113 59/242 (24%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/226 (23%)
Tryp_SPc 42..244 CDD:214473 52/223 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.