DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG31220

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:107/241 - (44%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DCGVPMQLIPKIVGGVDAGELKNPWMALI--------KTNDEFI--CGGSVITNKFVLTAAHCMC 80
            |||.| |...:::||.:....:.||:|::        ..:.|.:  ||||:|..::|||||||: 
  Fly    94 DCGKP-QTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCV- 156

  Fly    81 TDEECIVKYTQLTVTLGVYHLLATGEHNHPHE-----------------IYNVERVYIHDSFAIQ 128
            ||....::..:|            |||...|.                 ..:||.:..|:.:...
  Fly   157 TDTVLQIQRVRL------------GEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPA 209

  Fly   129 NY--RNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTG---NGKMSNNLQ 188
            ||  ||||||:||::.:.|.....|:|:|  |.  |::.:..:....|||.||   .|.......
  Fly   210 NYTFRNDIALVRLKEPVRYTMAYYPICVL--DY--PRSLMKFKMYVAGWGKTGMFDTGSKVLKHA 270

  Fly   189 MVKIYRIDRKMCEAAFWYTFDYPMF--CAGTAVGRDTCKRDSGGPL 232
            .||:.:.:.  |...:.:....|.|  |||....|.||..|||.||
  Fly   271 AVKVRKPEE--CSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 66/231 (29%)
Tryp_SPc 37..276 CDD:238113 66/230 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 66/231 (29%)
Tryp_SPc 104..360 CDD:238113 66/230 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.