DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG31205

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:238 Identity:63/238 - (26%)
Similarity:104/238 - (43%) Gaps:53/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 WLAE---VYKD--SFIISNGALISKTFVVTTAQLIS--ESTAL-KVQLGQGD-VHTYAVASVHKH 373
            |:..   |.||  :.::..|.||....|||.|..:|  ||.:: .|..|..| .:...|::|..|
  Fly    51 WVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVTVH 115

  Fly   374 P-----KFVSLAQNDIALLKLGEEVQYTESIRPICLPSLSNKAEQQKFQRRAADPALNLIAVGWG 433
            |     ||    :||:|:::|.:||.:::.::||||||:|......:....      .||..|..
  Fly   116 PDYSPRKF----ENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNS------KLIVAGLE 170

  Fly   434 TPT---------------NVVVRRTNASKCYREDHQDIGEQQLCMESPSPHLLRVGIGSPLVNPL 483
            .|:               .:...:.::.:|: |......|:.:|..:....|    .||.|..  
  Fly   171 GPSFDRRHSATQRLDKRIKMTYTKIDSKECH-EKQARFPEELICGHTERSPL----SGSALTE-- 228

  Fly   484 THGNRRAFSLVGLASFGRLEPFASNV----YTNVLEYLDWIGE 522
            ..|..|.|.|:|:|..|.   |:|::    |.|:..:||||.:
  Fly   229 ASGTPRQFHLLGIAVAGF---FSSDLDHQGYLNIRPHLDWISK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473
Tryp_SPc 37..276 CDD:238113
Trypsin 310..520 CDD:278516 61/234 (26%)
Tryp_SPc 313..520 CDD:304450 61/234 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 38/126 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.