DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and spirit

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:262 Identity:90/262 - (34%)
Similarity:122/262 - (46%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGVDAGELKNPWMALIKTNDEF------ICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVT 95
            :|||:.....:.|:||.:.....|      .|||::|.|.||||||||.....|     ....|.
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGE-----PPSQVR 191

  Fly    96 LGVYHL-LATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQ 159
            ||..:| |..||.      .::.||.||..::.....||||||.|:.:.  ||::||.||...  
  Fly   192 LGGDNLTLTEGED------ISIRRVIIHPDYSASTAYNDIALLELETAA--KPELKPTCIWTQ-- 246

  Fly   160 LKPQTDLIQEFTAIGWGVTG-NGKMSNNLQMVKIYRIDRKMCEAAFWYTFDY-------PMFCAG 216
             |..|:.:  .||||:|.|. .|..|..|..|.:..:..:.|:  ..|..|.       ...|||
  Fly   247 -KEVTNTL--VTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQ--HHYQKDQLAQGVLGTQMCAG 306

  Fly   217 TAVG-RDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGF--GMYTDVMGHIDFIERIVL 278
            ...| ||||:.||||||   ::.||: ....:||.|.| :.|...  .:||.|...:|:||.||.
  Fly   307 DITGERDTCQGDSGGPL---LMQDGL-LGYVVGITSLG-QGCASGPPSVYTRVSSFVDWIEGIVW 366

  Fly   279 DA 280
            .|
  Fly   367 PA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 85/253 (34%)
Tryp_SPc 37..276 CDD:238113 87/256 (34%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 87/256 (34%)
Tryp_SPc 132..361 CDD:214473 85/253 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.