DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG18420

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:304 Identity:106/304 - (34%)
Similarity:152/304 - (50%) Gaps:37/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSARLLDEDCGV--PMQLIPKIVGGVDAGELKNPWMALIKT-NDEFICGGSVITNKFVLTAAHCM 79
            ||.:.||.:||.  |::|.|:||.|..|....:||||.:.| :::|||||::|:.:.||||||  
  Fly    22 GSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAH-- 84

  Fly    80 CTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIV 144
                 |.:..|.:.|.||.|:....|.    .|.:.|.|.:.|..:....:.||||||||..::|
  Fly    85 -----CFIPNTTIVVRLGEYNRKLKGY----REEHQVNRTFQHRFYDPNTHANDIALLRLVSNVV 140

  Fly   145 YKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFD 209
            ||..|:|:||:.:...|...|.|:..|..|||.|.:...|:.|:.:.|.|...|||  ||.....
  Fly   141 YKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC--AFGSVLS 203

  Fly   210 YPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIE 274
             ..||||. ...:.|..|:|||:...:.:....|..|:||..| .:.|:...::||||.||:||.
  Fly   204 -NQFCAGN-WNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAIT-NKRCQRPSVFTDVMSHIEFIR 265

  Fly   275 RIVLDADIEVVLPYIDLLDAGCLGNDTLNSWDRSGPDAIRSFEW 318
            ||.|..:                |||  .:.....||....|:|
  Fly   266 RIFLTQN----------------GND--RNQPTPKPDKEPEFDW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 85/237 (36%)
Tryp_SPc 37..276 CDD:238113 87/239 (36%)
Trypsin 310..520 CDD:278516 4/9 (44%)
Tryp_SPc 313..520 CDD:304450 2/6 (33%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 85/237 (36%)
Tryp_SPc 43..267 CDD:238113 87/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463352
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.