DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG33226

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:268 Identity:94/268 - (35%)
Similarity:142/268 - (52%) Gaps:24/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLDEDC-GVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCMCTDEEC 85
            |||.:| ..|:.:..:|:||.:|....:|||..|.......||||:|::.||||||||..     
  Fly    31 LLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHS----- 90

  Fly    86 IVKYTQLTVTLGVY-----HLLATGEHNHPH--EIYNVERVYIHDSFAIQNYRN-DIALLRLQKS 142
              :| :|.|..|.|     ..|.:.::..|.  || :|:|:::|.|:  ::|.| ||||..|.|.
  Fly    91 --RY-RLKVRFGRYSGITPRYLCSSQYCSPFGPEI-DVKRIFLHSSY--RDYHNYDIALFLLAKP 149

  Fly   143 IVYKPQIKPLCILL---NDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAF 204
            :.|..|.:|:|:|.   .|:|:...:.:..|...|||.|.:...|..||...::.:|||.|...|
  Fly   150 VRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIF 214

  Fly   205 WYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGH 269
            .....:|..|||.:.. .||..||||||...:.|.|:||....||:|.|..:||...::|:|:.:
  Fly   215 DRKIGWPHICAGHSQS-STCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREVTVFTNVLRY 278

  Fly   270 IDFIERIV 277
            .::|..||
  Fly   279 SNWIRDIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 86/247 (35%)
Tryp_SPc 37..276 CDD:238113 87/249 (35%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 87/249 (35%)
Tryp_SPc 47..282 CDD:214473 86/246 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.