DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG33458

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:285 Identity:91/285 - (31%)
Similarity:138/285 - (48%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCM--- 79
            |.:.||:.|||: .:...:|.||.|:..:.|||:|.:..|.:||||||::.:.||||||||.   
  Fly    20 GYSYLLEWDCGI-SKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDK 83

  Fly    80 ------------------CTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFA 126
                              |.:.||..                      ||..|.:.:..||..:.
  Fly    84 NAKVLVRLGENDASQKIDCNESECAA----------------------PHLEYMIMQKLIHPLYR 126

  Fly   127 IQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVK 191
            ..:| .||||.:|.:.:||...|:|:|::||...:...|.|:.|...|||.|...::|:.||:.:
  Fly   127 TAHY-YDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTR 190

  Fly   192 IYRIDRKMCEAAFWYTFDYPMFCAGTA---VGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTG 253
            |.:|||..|...|.|..|....|||.:   ||    |.||||||...:.:...||..|.||||..
  Fly   191 IPQIDRFTCRYWFGYMVDRTHICAGESKHYVG----KGDSGGPLGSMVDYKYAKRFFQFGIVSHL 251

  Fly   254 TEDCRGFGMYTDVMGHIDFIERIVL 278
            .:...|..::|:::.:.::|.|.::
  Fly   252 RQPFHGVSVFTNILSYSNWIHRTII 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 83/260 (32%)
Tryp_SPc 37..276 CDD:238113 84/262 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 83/260 (32%)
Tryp_SPc 38..274 CDD:238113 84/262 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.