DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG33461

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:290 Identity:97/290 - (33%)
Similarity:149/290 - (51%) Gaps:34/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AWVVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVIT 68
            |::.||  :|.....|:..|:|:|||..:|..||:.|..|...:.||||.:.|...|:|.||:|.
  Fly    11 AYLALF--VLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLIN 73

  Fly    69 NKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEI-------------YNVERVY 120
            ..||||:|||:..|.|.|.:               .||:|..::|             |||:.::
  Fly    74 QWFVLTSAHCIEDDVELIAR---------------LGENNRDNDIDCENNRCLEATQEYNVDMLF 123

  Fly   121 IHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTG---NGK 182
            .|..:..:::.|||.:|||::.:.|...|:|:||..:.:::...|.|..|.|.|||:|.   |.|
  Fly   124 KHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTK 188

  Fly   183 MSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQL 247
            .|..|..:.:||..|..|...|...|.....|||...| :.|:.|||||...::|..|:||..|:
  Fly   189 SSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRFVQM 252

  Fly   248 GIVSTGTEDCRGFGMYTDVMGHIDFIERIV 277
            ||.|...|:|....:.|||:.:..:|:::|
  Fly   253 GIASFTYENCSKVSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 84/252 (33%)
Tryp_SPc 37..276 CDD:238113 84/254 (33%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 84/252 (33%)
Tryp_SPc 42..281 CDD:238113 84/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463320
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.