DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG30288

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:275 Identity:88/275 - (32%)
Similarity:132/275 - (48%) Gaps:39/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SARLLDEDCGVPMQ--LIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCMCT 81
            |.|||:.|||....  ...:|.||.|||...||||..:..:.:.:||||:||.:|||||.||:..
  Fly    23 SGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISP 87

  Fly    82 DEECIVKYTQLTVTLGVYHLLATGEHNHPHEIY--------------NVERVYIHDSFAIQNYRN 132
                            :|..:..||::..|.|:              :|:|..:|     .|...
  Fly    88 ----------------MYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVH-----SNPGY 131

  Fly   133 DIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDR 197
            ||.|||:|:|:::...::|:|::|...|......|..|...|||...:|:..:.||...:.::.:
  Fly   132 DIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQ 196

  Fly   198 KMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGM 262
            ..||.. ....|....|||:.:. |:||.||||||.....|:|..|..|.|:.|.|...|.|.|:
  Fly   197 WSCERP-GRPLDISYICAGSYIS-DSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGLGI 259

  Fly   263 YTDVMGHIDFIERIV 277
            ||:|....|:|..::
  Fly   260 YTNVTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 80/250 (32%)
Tryp_SPc 37..276 CDD:238113 81/252 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 80/250 (32%)
Tryp_SPc 45..270 CDD:238113 79/247 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.