DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG30087

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:283 Identity:98/283 - (34%)
Similarity:143/283 - (50%) Gaps:21/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AWVVLFAWMLTAGR-GSARLLDEDCGV--PMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGS 65
            ||.|:...::...| ..|:.|:..|||  ..|...::|.|.:|.....|:|..:..|....||||
  Fly     6 AWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGS 70

  Fly    66 VITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLL----ATGEHNHPH-EIYNVERVYIHDSF 125
            ::.::::||||||:         :..|.:.||.:::.    ..|.:..|. |.|.:.:...|..:
  Fly    71 ILNSRYILTAAHCV---------FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFY 126

  Fly   126 AIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMV 190
            ...|:.||||||:|.:||.:...|:|:|||||....|.....|.|   |||.|......:.||..
  Fly   127 NAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTF---GWGETKKNGFPHLLQTA 188

  Fly   191 KIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTE 255
            ::...|...|..:|....:....|||.. .||||..||||||...:.|||:||..||||||.|..
  Fly   189 ELRAYDAAYCSRSFHAYMNGNQICAGHE-ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPT 252

  Fly   256 DCRGFGMYTDVMGHIDFIERIVL 278
            ||:..|:||.|..:|::|.|.:|
  Fly   253 DCQSPGVYTYVPNYINWIRRAML 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 85/241 (35%)
Tryp_SPc 37..276 CDD:238113 86/243 (35%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 85/241 (35%)
Tryp_SPc 42..272 CDD:238113 86/242 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463351
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.