DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG30002

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:287 Identity:99/287 - (34%)
Similarity:146/287 - (50%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLDEDCGVPMQLIP------KIVGGVDAGELKNPWMALIKTNDEF---ICGGSVITNKFVLTAAH 77
            |..:||||....||      .|.||..:..:..||||.:....:.   .||||:|:..|||||||
  Fly    41 LTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAH 105

  Fly    78 C--MCTDEECIVKYTQLTVTLGVYHLLATGE---HNH------PHEIYNVERVYIHDSFAIQNYR 131
            |  ||.      :..::.|.||...|.:|.:   :|:      |.|.:.:::..:|:.|.:....
  Fly   106 CFKMCP------RSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPG 164

  Fly   132 NDIALLRLQKSIVYKPQIKPLCILLNDQLKPQT-DLIQEFTAIGWGVTGNGKMSNNLQMVKIYRI 195
            .||||::|.|.:|:|..|:|:|:.|.|:|...| .|.|.|.|:|||.|.:.:.:|:...|.| |.
  Fly   165 YDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTESLRYANSTMEVDI-RT 228

  Fly   196 DRKMCEAAFWYTFDYPMFCA-GTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRG 259
            ::  |...    .|....|| |..|  |||..||||||.......|..||.|.|:||||:::| |
  Fly   229 EK--CTDG----RDTSFLCASGDYV--DTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNC-G 284

  Fly   260 FG---MYTDVMGHIDFI-ERIVLDADI 282
            .|   .|.||..::.:| |::...:|:
  Fly   285 AGHKAYYMDVPTYMPWILEKMAEFSDV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 89/255 (35%)
Tryp_SPc 37..276 CDD:238113 91/258 (35%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 89/254 (35%)
Tryp_SPc 62..301 CDD:238113 89/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.