DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and PRSS54

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:364 Identity:73/364 - (20%)
Similarity:139/364 - (38%) Gaps:81/364 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CGVPMQLIPKIVGGVDAGE-----LKNPWMALIKTND-EFICGGSVITNKFVLTAAHCMCTDEEC 85
            |||..   ..:..|.|..|     ::.||:..::.:. ..:..|.:::..:||:.|       ..
Human    30 CGVQK---ASVFYGPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVLSIA-------SA 84

  Fly    86 IVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIK 150
            |.....:.|.:|:.::   ......|..|.|..:.||:.|...:..|:||||:...::.:...::
Human    85 IQNRKDIVVIVGISNM---DPSKIAHTEYPVNTIIIHEDFDNNSMSNNIALLKTDTAMHFGNLVQ 146

  Fly   151 PLCILLNDQLKPQTDLIQEFTAIGW---GVTGNG-KMS-------NNLQMVKIYRIDRKMCEAAF 204
            .:|.|  .::.....::|.....||   ..|||. .||       .:|.|..:|::.:..|    
Human   147 SICFL--GRMLHTPPVLQNCWVSGWNPTSATGNHMTMSVLRKIFVKDLDMCPLYKLQKTEC---- 205

  Fly   205 WYTFDYPMFCAGTAVGRDT---CKRDSGGPLYIHM-LFD-GIKRATQLGIVSTGTEDCRGFGMYT 264
                       |:....:|   |..|.|.|:...: .|| .:.|    |:::.|.|.|.|..:||
Human   206 -----------GSHTKEETKTACLGDPGSPMMCQLQQFDLWVLR----GVLNFGGETCPGLFLYT 255

  Fly   265 DVMGHIDFIERIVLDADIEVVLPYIDLLDAGCLGNDTLNSWDR------SGPDAIRSFEWLAEVY 323
            .|..:..:|     .:..|...|.:          .:|:.|::      .||:|..:    .:.|
Human   256 KVEDYSKWI-----TSKAERAGPPL----------SSLHHWEKLISFSHHGPNATMT----QKTY 301

  Fly   324 KDSFIISNGALISKTFVVTTAQLISESTALKVQLGQGDV 362
            .||.:...|:.:.......|...:..|:...:.:.:.||
Human   302 SDSELGHVGSYLQGQRRTITHSRLGNSSRDSLDVREKDV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 54/258 (21%)
Tryp_SPc 37..276 CDD:238113 55/260 (21%)
Trypsin 310..520 CDD:278516 10/53 (19%)
Tryp_SPc 313..520 CDD:304450 8/50 (16%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 51/242 (21%)
Tryp_SPc 52..264 CDD:238113 51/242 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.