DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and T22A3.6

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:225 Identity:37/225 - (16%)
Similarity:67/225 - (29%) Gaps:99/225 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSARLLDEDCGVPMQLIPKIVGGVDAGELKN---PWMALI-KTNDEFICGG-------------- 64
            |..||..:.|             ::.|.:.|   ||:|:: :|..:|:...              
 Worm   229 GVQRLSTKSC-------------INKGHIANHFGPWIAVLDQTATQFLAAAGRRKLRDLCFPSFN 280

  Fly    65 ---------SVITNKFV---LTAAHC--------MCTDE-----------------------ECI 86
                     .::.:..:   ||.:.|        .|.|:                       :||
 Worm   281 EHEIFTYQQGILLDAIIEDELTISGCTFWRRCFSSCQDDLATCWLKSQKGYFGSKATSVSGKQCI 345

  Fly    87 VKYTQLT-----------VTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQ 140
             .:||.|           .:.||||:........|.:.:...|:::       |......||..:
 Worm   346 -PWTQATSEILSMVKVNSTSSGVYHMYHRLLFEDPSQFFTESRLFM-------NTEASCMLLNRR 402

  Fly   141 KSIVYKPQIKPLCILLNDQLKPQTDLIQEF 170
            .|:..|...|......|::      |:.||
 Worm   403 NSVEVKNSYKESPFFTNEK------LVSEF 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 33/207 (16%)
Tryp_SPc 37..276 CDD:238113 33/206 (16%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
T22A3.6NP_492773.3 KR 98..173 CDD:350900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.