Sequence 1: | NP_725484.1 | Gene: | CG30091 / 246449 | FlyBaseID: | FBgn0050091 | Length: | 526 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492773.3 | Gene: | T22A3.6 / 188711 | WormBaseID: | WBGene00011909 | Length: | 491 | Species: | Caenorhabditis elegans |
Alignment Length: | 225 | Identity: | 37/225 - (16%) |
---|---|---|---|
Similarity: | 67/225 - (29%) | Gaps: | 99/225 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 GSARLLDEDCGVPMQLIPKIVGGVDAGELKN---PWMALI-KTNDEFICGG-------------- 64
Fly 65 ---------SVITNKFV---LTAAHC--------MCTDE-----------------------ECI 86
Fly 87 VKYTQLT-----------VTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQ 140
Fly 141 KSIVYKPQIKPLCILLNDQLKPQTDLIQEF 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30091 | NP_725484.1 | Tryp_SPc | 36..273 | CDD:214473 | 33/207 (16%) |
Tryp_SPc | 37..276 | CDD:238113 | 33/206 (16%) | ||
Trypsin | 310..520 | CDD:278516 | |||
Tryp_SPc | 313..520 | CDD:304450 | |||
T22A3.6 | NP_492773.3 | KR | 98..173 | CDD:350900 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |