DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG43742

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:558 Identity:150/558 - (26%)
Similarity:256/558 - (45%) Gaps:119/558 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCRAWVVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGS 65
            ||..:.:|...::......|:||||:|.|  ::..::..|..|  :.:.:||.:..|.||.||||
  Fly     1 MCCWFSLLLVAVVIYQNAFAQLLDENCKV--KITYRVANGHTA--ITSQFMAALYNNSEFFCGGS 61

  Fly    66 VITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNH-------PHEIYNVERVYIHD 123
            :|..::|||||||:...:|..|            ||   ||:|.       .|.:....:|.:|.
  Fly    62 LIHKQYVLTAAHCVRDLDEVTV------------HL---GENNRSCPIPVCKHVLRLNAKVILHP 111

  Fly   124 SFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQ 188
            :|....:.||||||||::.::::..|:|:||:|::.:.....  ..|||.|||.|.:|.:|:.|.
  Fly   112 NFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQ--NNFTAYGWGKTEHGNISDVLS 174

  Fly   189 MVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTG 253
            .:.:.|:.:.||..      :....|||:..| |||:.||||||..:.:..|..|....||.|.|
  Fly   175 FIDLVRLPKSMCYQ------NINTICAGSTSG-DTCESDSGGPLIGNFVHRGKSRDILFGITSYG 232

  Fly   254 TEDCRG-FGMYTDVMGHIDFIERIVLDADIEVVLPYIDLLDAGCLGNDTLNSWDRSGPDAIRSFE 317
            ..:|.| ||:||||..:..:|..:||:::..:                 ||.:.:|        :
  Fly   233 DAECSGLFGVYTDVNAYKSWIASVVLESEPRL-----------------LNEYCKS--------D 272

  Fly   318 WLAEVYKDSFIIS------NGALISKTFVVTTAQLISES-TALKVQLGQGDVHTYAVASVHKHPK 375
            |.|:::...:.:|      .||||:..||||.|..:.:: .|.|:::....:..|.|....|||.
  Fly   273 WGAKIFLRLWEMSLFEHKFAGALITNQFVVTVASALPDNFNASKIKVESKYLQVYDVDWALKHPH 337

  Fly   376 F--VSLAQNDIALLKLGEEVQYTESIRPICLPSLSNKAEQQKFQRRAADPALNLIAVGWGTPTNV 438
            |  ....:|:|||::|.:.:..:....||||                        .:.:.:||  
  Fly   338 FEQAPRIRNNIALIRLAKMIPRSIFEIPICL------------------------GLNFDSPT-- 376

  Fly   439 VVRRTNASKCYREDHQDIGEQQL--------------CMESPSP--HLLRVGIGSPLVNPLTHGN 487
                |..:..|..:::.:|.||:              |:|.|..  :|.....||.:........
  Fly   377 ----TWNALLYSANNRFLGSQQVNLKRIHDCFEPNEYCVEKPDKLNYLPYDTPGSVIGTSQMFKG 437

  Fly   488 RRAFSLVGLASFGRLEPFASNVYTNVLEYLDWIGEMVK 525
            |..:.:.|:.|..:.:..   |:||:.::::||..::|
  Fly   438 REIYLIAGIISHTQGDVI---VFTNIQDHVEWITTIMK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 83/244 (34%)
Tryp_SPc 37..276 CDD:238113 84/246 (34%)
Trypsin 310..520 CDD:278516 48/234 (21%)
Tryp_SPc 313..520 CDD:304450 48/231 (21%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 83/244 (34%)
Tryp_SPc 35..256 CDD:238113 84/246 (34%)
Tryp_SPc 273..467 CDD:214473 48/226 (21%)
Tryp_SPc 273..>368 CDD:304450 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463408
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.