DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Egfbp2

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:277 Identity:77/277 - (27%)
Similarity:118/277 - (42%) Gaps:45/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WVVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITN 69
            |.::....|:.|       ..|...|:|  .::|||.:..:...||...:....|.||||.::..
Mouse     2 WFLILFLALSLG-------GIDAAPPLQ--SRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLDR 57

  Fly    70 KFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLL---ATGEH-----NHPHEIYNVERVYIHDSFA 126
            .:|||||||.         ..|..|.||...|.   .:.:|     :.||..:|:..:.:.....
Mouse    58 NWVLTAAHCY---------VDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPP 113

  Fly   127 IQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWG--VTGNGKMSNNLQM 189
            ..::.||:.||||.|.......:||:. |...:.||.:..:    |.|||  .....:..::||.
Mouse   114 GADFSNDLMLLRLSKPADITDVVKPIA-LPTKEPKPGSKCL----ASGWGSITPTRWQKPDDLQC 173

  Fly   190 VKIYRIDRKMCEAAFWYTFDYPMFCAG-TAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTG 253
            |.|..:..:.|...:.......|.||| ...|:|||:.||||||    :.|||.:    |..|.|
Mouse   174 VFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPL----ICDGILQ----GTTSYG 230

  Fly   254 TEDCRGFG---MYTDVM 267
            ...|...|   :||:::
Mouse   231 PVPCGKPGVPAIYTNLI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 71/246 (29%)
Tryp_SPc 37..276 CDD:238113 71/245 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 71/246 (29%)
Tryp_SPc 25..256 CDD:238113 71/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.