DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG43335

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:296 Identity:92/296 - (31%)
Similarity:138/296 - (46%) Gaps:50/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCRAWVVLFAWMLTAGRGSARLLDEDCGVPMQLIP-----KIVGGVDAGELKNPWMALIKTNDEF 60
            :|: |:..|        |.:|||:.:||:  :.:|     :|:||.||....:||||.:.....:
  Fly    12 VCQ-WLCRF--------GESRLLEPNCGI--RTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHY 65

  Fly    61 ICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLG----------VYHLLATGEHNHPHEIYN 115
            .|.|::|||:|||||||       ||.....|||.||          :..:.|        |.|:
  Fly    66 FCAGTLITNQFVLTAAH-------CIEASKNLTVRLGGSGLTRSDGSMCQITA--------EDYS 115

  Fly   116 VERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQE----FTAIGWG 176
            |.....|..|......||||::||.:::.:...|:|:||:|:    |...|:.|    ..|.|||
  Fly   116 VSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILD----PAVRLLLEDGMTLMATGWG 176

  Fly   177 VTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGI 241
            :.......:.||...|..::|.:|...:.........|||.. ..:||..||||||...:.:.|.
  Fly   177 LADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDK-ETNTCLGDSGGPLGGVVNYYGD 240

  Fly   242 KRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIERIV 277
            .|..|.||.|.|..:||...:|||:..:..:|..:|
  Fly   241 LRFVQYGITSFGDIECRSPSIYTDLSTYSGWINMVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 80/250 (32%)
Tryp_SPc 37..276 CDD:238113 81/252 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 80/250 (32%)
Tryp_SPc 42..275 CDD:238113 81/252 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463355
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.