DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG43124

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:297 Identity:76/297 - (25%)
Similarity:117/297 - (39%) Gaps:85/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WVVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITN 69
            |:|| ..:|...:|||:.|:|||...|:.|        .|....||:|.|.::.:.||.|::|.|
  Fly     6 WIVL-CIVLMFYQGSAQTLEEDCVDHMERI--------NGSSYAPWLAEILSDSKVICAGALINN 61

  Fly    70 KFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDI 134
            .:|||||.|...:|       :|||.||      :|..:..:|.:.|.:.|...:....|..|::
  Fly    62 LYVLTAASCFKENE-------KLTVRLG------SGYFDKSYENFRVTKAYFWMTHFPANNTNNL 113

  Fly   135 ALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKM 199
            .:.|||..:.:|..|:|:||.                          |...:|.:...:.|..: 
  Fly   114 CIFRLQTEVEFKTHIRPMCIT--------------------------KSPKSLGLATTFEIINE- 151

  Fly   200 CEAAFWYTFDYPMFC-------------------AGTAVGRDTCKRDSGGPLYIHMLFDGIKRAT 245
             :...||      ||                   .....|....:..|.||      |.|:.|..
  Fly   152 -KPKMWY------FCKNIKGLFCKYVFGENEEKWQSKPTGSPWTETISNGP------FKGLVRYG 203

  Fly   246 QLGIVSTGTEDCRGFGMYTDVMGHIDFIERIVLDADI 282
            .|......|.|    .:|.:||.||::|.:|.|:.||
  Fly   204 ILSYRDNKTYD----EVYINVMSHINWIAQISLEIDI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 58/255 (23%)
Tryp_SPc 37..276 CDD:238113 59/257 (23%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 33/104 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.