DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG34171

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:104/252 - (41%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YIHS-SVKLICGGTLITQRFVLTAAHCVNEGSAVKV---RLGEYDDTATEDCNSKICIPRAEEHD 116
            |||: .....|.|.::|.|.|||:|||:.:.:.|.:   |:      ....|.|....|.:||..
  Fly    47 YIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRI------VVALCASLFKTPESEEFV 105

  Fly   117 VDM--AFRHGKFSEIKNLNDIALLRLAKFVTFKA-HISPICIILGTSKRELVDSIEWFVATGWGE 178
            ||:  ...|..:...:: ||||:::|.::|.... |::|  ::||.|..|:.:..          
  Fly   106 VDIHNMIIHPYYHRNQH-NDIAIIKLKRYVKLDGHHLAP--VVLGNSSLEVGNDC---------- 157

  Fly   179 TRTHRTRGVLQITQLQRYNS--------------SQCMQALGRLV-----QQNQICAGRLGSDTC 224
                :|.|.:...:.||:.|              .:|::....|:     .::.||........|
  Fly   158 ----KTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMC 218

  Fly   225 NGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG--VYTDVYSYADWIATVVQQ 279
            ..|.|||||     .|.    |...::.||..||...  .::||..|..|:..::.:
  Fly   219 TTDFGGPLF-----CDG----QLYGIALGSINCSSPDPVFFSDVSFYNSWVTKIISE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 60/244 (25%)
Tryp_SPc 40..276 CDD:238113 61/247 (25%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 60/244 (25%)
Tryp_SPc 38..263 CDD:304450 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.