DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:100/267 - (37%) Gaps:93/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NSNPWMAYIHSSVKLICGGTLITQRFVLTAAHCVNEGSAVKVRLG-------EYDDTATEDCNSK 106
            |.|.|           |||::|...:|||||||.|..|.|.:..|       :|           
  Fly    60 NGNWW-----------CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQY----------- 102

  Fly   107 ICIPRAEEHDVDMA--FRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE 169
                   .|.|...  .:|..::.....|||:|:| ...|.|               ..||:.:|
  Fly   103 -------THWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDF---------------WHLVNKVE 144

  Fly   170 --------------WFVATGWGETRTHRTRGV-----LQITQLQRYNSSQCMQALGRLVQQNQIC 215
                          |.||:|||.|..    |.     ||...:|..:.|.|.:...  :..|.||
  Fly   145 LPSYNDRYQDYAGWWAVASGWGGTYD----GSPLPDWLQAVDVQIMSQSDCSRTWS--LHDNMIC 203

  Fly   216 AG-RLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSY-GSREC-SGI-GVYTDVYSYADWIATV 276
            .. ..|..||.|||||||   |.| :..|.|  ||.|: .|..| ||. .|::.|..|.|||   
  Fly   204 INTNGGKSTCGGDSGGPL---VTH-EGNRLV--GVTSFVSSAGCQSGAPAVFSRVTGYLDWI--- 259

  Fly   277 VQQNTHV 283
             :.||.:
  Fly   260 -RDNTGI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 73/255 (29%)
Tryp_SPc 40..276 CDD:238113 75/258 (29%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 73/255 (29%)
Tryp_SPc 38..262 CDD:238113 75/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.