DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:279 Identity:73/279 - (26%)
Similarity:108/279 - (38%) Gaps:77/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTA 78
            |.|.|.|...|:   .|::.|:             |.|.|.          |||::|...:||||
  Fly    44 GNLASEGQVPYI---VGVSLNS-------------NGNWWW----------CGGSIIGHTWVLTA 82

  Fly    79 AHCVNEGSAVKVRLG--EYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNL--------- 132
            |||........:..|  .|::.                     ||||...||  |.         
  Fly    83 AHCTAGADEASLYYGAVNYNEP---------------------AFRHTVSSE--NFIRYPHYVGL 124

  Fly   133 -NDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE--WFVATGWGETRTHRTRGV---LQIT 191
             :|:||:: ...|.|.:.::.|.:   .|..:..:|.|  |..|.|||  ..:....|   |::.
  Fly   125 DHDLALIK-TPHVDFYSLVNKIEL---PSLDDRYNSYENNWVQAAGWG--AIYDGSNVVEDLRVV 183

  Fly   192 QLQRYNSSQCMQALGR-LVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGS 254
            .|:..:.::|....|. ...:|.||.... |..||.|||||||  ..:..||:..:...|.:||.
  Fly   184 DLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPL--VTKEGDKLIGITSFVSAYGC 246

  Fly   255 RECSGIGVYTDVYSYADWI 273
             :..|...:|.|..|.:||
  Fly   247 -QVGGPAGFTRVTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 64/252 (25%)
Tryp_SPc 40..276 CDD:238113 66/253 (26%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 71/277 (26%)
Tryp_SPc 41..266 CDD:238113 73/279 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.