DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG11842

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:276 Identity:93/276 - (33%)
Similarity:127/276 - (46%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IIGGRDAIINSNPWMAYI-----HSSVKLICGGTLITQRFVLTAAHC--VNEGSAVKVRLGEYD- 96
            ||||..|:....|..|.:     :..|:..||||||:.|.|||||||  ..:||....|||:.: 
  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEF 137

  Fly    97 DTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICI-----I 156
            ||..:|.:       .|:.||.....|.:||.....|||:::||::.|||..:..|.|:     .
  Fly   138 DTNNDDAD-------PEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGR 195

  Fly   157 LGTSKRELVDSIEWFVATGWGE----TRTHRTRGVLQITQLQRYNSSQCMQALGRLVQ------- 210
            ||||          |:|.|||:    .||...:  ||..:|..| .::|.....|..:       
  Fly   196 LGTS----------FIAIGWGQLEIVPRTENKK--LQKVKLYNY-GTRCRITADRNDELPEGYNA 247

  Fly   211 QNQICAG-RLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV----------YT 264
            ..|:|.| ....||||||||||:.  :.|||  .|..:.|:...|     |||          ||
  Fly   248 TTQLCIGSNEHKDTCNGDSGGPVL--IYHMD--YPCMYHVMGITS-----IGVACDTPDLPAMYT 303

  Fly   265 DVYSYADWIATVVQQN 280
            .|:.|.|||...:.:|
  Fly   304 RVHFYLDWIKQQLAKN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 90/267 (34%)
Tryp_SPc 40..276 CDD:238113 92/270 (34%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 92/270 (34%)
Tryp_SPc 73..312 CDD:214473 90/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.