DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG5909

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:269 Identity:95/269 - (35%)
Similarity:142/269 - (52%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVK----LICGGTLITQRFVLTAAHC-VNEGSAV 88
            ||...|.   |:.||:.|.....||:|.:...:.    ..|||:||::|.:|||||| :::...:
  Fly   122 CGNKGNP---KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVI 183

  Fly    89 KVRLGEYDDTATEDCN-----SKICIPRAEEHDVDMA-----FRHGKFSEIKNLNDIALLRLAKF 143
            .|||||:|..:.|||:     :::|||..||:.::..     :.|||.|     :|:|:::|.:.
  Fly   184 AVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKIS-----HDVAIIKLDRV 243

  Fly   144 VTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGR- 207
            |..|:||.|:|:.:....:||.....:||| |||.|........||...:.|.:.::|.|...: 
  Fly   244 VKEKSHIKPVCLPIDQKSQELDFDQSFFVA-GWGGTEKETVATKLQQALITRKSLNECRQYYNKG 307

  Fly   208 LVQQNQICAGRLG-SDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSREC--SGIGVYTDVYSY 269
            .|..|.|||...| ..||.||||||:|...|..:..|.||:||||:|.|.|  :..||:..|...
  Fly   308 EVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDM 372

  Fly   270 ADWIATVVQ 278
            ..||...:|
  Fly   373 LPWITQNLQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 89/252 (35%)
Tryp_SPc 40..276 CDD:238113 90/254 (35%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 89/252 (35%)
Tryp_SPc 132..379 CDD:238113 90/252 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.