DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and grass

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:270 Identity:91/270 - (33%)
Similarity:139/270 - (51%) Gaps:23/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGLTANTIAFKIIGGRDAIINSNPWMAYIH----SSVKLICGGTLITQRFVLTAAHCVN--EGSA 87
            ||   |.::.::..|.:..::|.||||.:.    ...:.:|||.:|::|::|||||||:  :...
  Fly   111 CG---NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDL 172

  Fly    88 VKVRLGEYDDTATEDC----NSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKA 148
            .::||||:..:..|||    ..|.|.|......::....|.|:.....::|||||:|.:.|.|:.
  Fly   173 YEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQK 237

  Fly   149 HISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQNQ 213
            ||.|||:.:....:|..:.|..:..||||.|....:..||....:.....|.|.||..|.|..:|
  Fly   238 HIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVPLSQ 302

  Fly   214 ICAGRLG---SDTCNGDSGGPLFQTVRHMDKMRP--VQFGVVSYGSRECSGI---GVYTDVYSYA 270
            :|.|  |   .|:|.|||||||....:::.:..|  |:||:||.|...|..|   |:||:|..|.
  Fly   303 LCVG--GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYV 365

  Fly   271 DWIATVVQQN 280
            .||...:..|
  Fly   366 QWITDTMASN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 85/251 (34%)
Tryp_SPc 40..276 CDD:238113 87/253 (34%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 87/251 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.