DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG10232

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:276 Identity:90/276 - (32%)
Similarity:127/276 - (46%) Gaps:25/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMA-YIHSSVKLI-----CGGTLITQRF 74
            :|....|..|...||....  .:::..|..|..|..|||| .|:.:.:|.     |.|:||.:|:
  Fly   235 ICCPEPGNVLPTSCGQAPP--LYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRY 297

  Fly    75 VLTAAHCVNEGSAV-------KVRLGEYDDTATEDCN-SKICIPRAEEHDVDMAFRHGK-FSEIK 130
            ||||||||.:...|       :|||||:|.|...||: :..|.....|..::....|.: |:..:
  Fly   298 VLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSR 362

  Fly   131 NLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQR 195
            ..:||||:||...|.:...|.|||:    .|..:..........|||.|:......||....:..
  Fly   363 FESDIALVRLQTPVRYTHEILPICV----PKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYE 423

  Fly   196 YNSSQCMQALGRLVQQNQICA-GRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSG 259
             |...|...:.....::|||| |..|.|:|.|||||||..|:.:..:......|:|||||..|..
  Fly   424 -NRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGD 487

  Fly   260 --IGVYTDVYSYADWI 273
              .||||...::..||
  Fly   488 RKPGVYTKTGAFFSWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 83/251 (33%)
Tryp_SPc 40..276 CDD:238113 85/252 (34%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 85/249 (34%)
Tryp_SPc 260..503 CDD:214473 83/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463642
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.