DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG16710

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:265 Identity:99/265 - (37%)
Similarity:133/265 - (50%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AFKIIGGRDAIINSNPWMA---YIHSS-----VKLI--CGGTLITQRFVLTAAHCVN-EGSAV-K 89
            |::|.||.:...|..||||   |.|.|     .:|:  |.|:|||.|:|||||||:. .|..: :
  Fly   103 AYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRR 167

  Fly    90 VRLGEYDDTATEDCNSKI-----CIPRAEEHDVDMAFRHGKFS--EIKNLNDIALLRLAKFVTFK 147
            |||||::..:..||.:.|     |.|...|.|||::.:|..:.  |.:..||||||||...|.:.
  Fly   168 VRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYT 232

  Fly   148 AHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRY----NSSQCM---QAL 205
            |.|.|||:.|.........|.......|||.:.......||    ||.|    |:.:|.   .:|
  Fly   233 AQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVL----LQAYVNGRNADECSLSEPSL 293

  Fly   206 GRLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECS-GIGVYTDVYS 268
            | |.::..||||.| |:|||.|||||||...:...|:......|:.|||..:|. |...||....
  Fly   294 G-LDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAAYTKTSK 357

  Fly   269 YADWI 273
            :.:||
  Fly   358 FVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 96/261 (37%)
Tryp_SPc 40..276 CDD:238113 98/262 (37%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 96/261 (37%)
Tryp_SPc 106..362 CDD:238113 96/260 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.