DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG31199

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:247 Identity:50/247 - (20%)
Similarity:93/247 - (37%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWGAIAAITALAIGVL-CSLGNGEYLEPRCGLTANTIAFKIIGGRDAIIN---------SNPWMA 55
            |.|.| |:..|.:|:. ..:.:.:..:.:||      ||    ..|.::|         .:.|:|
  Fly     1 MLGRI-AVLLLLVGLFGPEVRSAKVNDDQCG------AF----DEDQMLNMQSTFAIPTEHQWVA 54

  Fly    56 YIHSSVKLI-------------CGGTLITQRFVLTAAHCVNE----GSAVKVRLGEYDDTA---T 100
                  :::             |.|.|:::|.||..|||..:    ..|..|.||.::.:|   .
  Fly    55 ------RIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGV 113

  Fly   101 EDCNSK-ICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKREL 164
            ..|.:. .|:..::|..:.....|..:......|.:|:|.|.:......::.|||:...:...|.
  Fly   114 RVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNET 178

  Fly   165 VDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLV-QQNQIC 215
            :.: :.||..|.......|.:     |.:...:...|...:..|| ..|.:|
  Fly   179 LVA-QTFVVAGLRVFEDFRLK-----TWVNTLSRGFCQSKVKTLVTSSNTVC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 40/208 (19%)
Tryp_SPc 40..276 CDD:238113 40/207 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 38/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.