DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG31219

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:282 Identity:103/282 - (36%)
Similarity:141/282 - (50%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGLTANTIAFKIIGGRDAIINSNPWMA---YIHSSVKLI---CGGTLITQRFVLTAAHCVN---- 83
            ||.:.:|  ::::||.:|..|..||||   |::::...|   |.|:||..|:|||:|||||    
  Fly    80 CGQSLST--YRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPR 142

  Fly    84 EGSAVKVRLGE----YDDTATEDC---NSKICIPRAEEHDVDMAFRHGKFSEIKNLN---DIALL 138
            :.|...|||||    ||.....||   :::..:|.. |..::....||.||.|.|.|   |||||
  Fly   143 DLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNL-EIKLEKIIVHGLFSSISNRNIEYDIALL 206

  Fly   139 RLAKFVTFKAHISPICI----ILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSS 199
            ||...|.::..|.||||    ....||.|:         .|||:|...:...||....::..:.:
  Fly   207 RLKMPVRYRTGIMPICIPKHGFFAKSKLEI---------AGWGKTNEGQFSQVLMHGFIRERSIA 262

  Fly   200 QCMQALG----RLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSG 259
            .|  ||.    .|.|..|||||.. |.|||.|||||||..|   ||.......|:.:|||:.|..
  Fly   263 VC--ALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVT---MDNSSVYLAGITTYGSKNCGQ 322

  Fly   260 I---GVYTDVYSYADWIATVVQ 278
            |   |:||...::..||..|::
  Fly   323 IGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 97/265 (37%)
Tryp_SPc 40..276 CDD:238113 99/267 (37%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 97/265 (37%)
Tryp_SPc 90..342 CDD:238113 99/266 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.