DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG4053

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:300 Identity:72/300 - (24%)
Similarity:121/300 - (40%) Gaps:69/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKL-ICGGT 68
            ::.|..|.:|....:..|:.|:.|     ..:..:|:||::|.....|:...|.:..|. ||.|.
  Fly     5 LSLIWLLLLGTSIDVTRGKRLDNR-----KLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGV 64

  Fly    69 LITQRFVLTAAHCVNEGSAVKVRL----------GE--YDDTATEDCNSKICIPRAEEHDVDMAF 121
            ::.::::|||.||..:.|...:|:          |:  :.|.|...|          .:|:...:
  Fly    65 ILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHC----------LYDIPYVY 119

  Fly   122 RHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETR-THRTR 185
            .          |||||:.:.:.:.|......:.:     .||...:......||||... ::.|.
  Fly   120 N----------NDIALIHVNESIIFNDRTQIVEL-----SREQPPAGSTVTLTGWGAPESSYPTV 169

  Fly   186 GVLQITQLQRYNSSQCMQAL----GRLVQQNQICA-GRLGSDTCNGDSGGPLFQTVRHMDKMRPV 245
            ..||...|......:|.:..    |  :....||. .|.|...|:|||||||....:.:      
  Fly   170 QYLQTLNLTIIAHEECRERWDFHDG--IDIGHICTFTREGEGACSGDSGGPLMWEGKLV------ 226

  Fly   246 QFGVVSYGSRECSGIG---VYTDVYSYADWIATVVQQNTH 282
              |:|::| |.| |:|   :|.:...|.|||     :.||
  Fly   227 --GLVNWG-RAC-GVGMPDMYANTVYYQDWI-----RRTH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 62/255 (24%)
Tryp_SPc 40..276 CDD:238113 64/257 (25%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 62/255 (24%)
Tryp_SPc 35..256 CDD:238113 64/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.