DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG17475

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:274 Identity:74/274 - (27%)
Similarity:112/274 - (40%) Gaps:55/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KIIGGRDAIINSNPWMAYI------HSSVKLICGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDD 97
            ::|.|.|..:....:...:      |     ||||.:|.:|.||||||||...:...:|:    .
  Fly    49 RVINGEDVQLGEAKYQISLQGMYGGH-----ICGGCIIDERHVLTAAHCVYGYNPTYLRV----I 104

  Fly    98 TATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISP-----ICIIL 157
            |.|.:......:...|||.:     |..::.....|||||:||...:.|..:..|     ..:..
  Fly   105 TGTVEYEKPDAVYFVEEHWI-----HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVAN 164

  Fly   158 GTSKRELVDSIEWFVATGWGETRT-HRTRGVLQITQLQRYNSSQCMQALGRLVQQN--QICAGRL 219
            ||.          .:.||||.|.. ..|..:||...|.....|.|.:.:.......  .||....
  Fly   165 GTQ----------LLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTT 219

  Fly   220 GSD-TCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV---YTDVYSYADWIATVVQ-- 278
            |.. .|:|||||||..        ..|.:|:|::| ..|: :||   :.:||.|.:||.:::.  
  Fly   220 GGQGACHGDSGGPLTH--------NGVLYGLVNWG-YPCA-LGVPDSHANVYYYLEWIRSMISGP 274

  Fly   279 -QNTHVPAPIMPNI 291
             .|.|..|...|::
  Fly   275 CSNCHCYASNYPSL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 68/251 (27%)
Tryp_SPc 40..276 CDD:238113 70/253 (28%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/251 (27%)
Tryp_SPc 50..269 CDD:238113 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.