DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG31326

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:268 Identity:81/268 - (30%)
Similarity:118/268 - (44%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGLTANTIAFKIIGGRDAIINSNPWMAYI-----HSSVKLICGGTLITQRFVLTAAHCVN----- 83
            ||....:....|..|:.......||:..|     .:....|||||||:...||:||||..     
  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRD 327

  Fly    84 -EGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLN--DIALLRLAKFVT 145
             ..|.:.|.||.         |:.......|...|.....|..| :.|...  |:||:||.:.|.
  Fly   328 LPASRLAVSLGR---------NTLAIHSDGEFRGVSQLIIHENF-QFKQFTEADLALVRLDEPVR 382

  Fly   146 FKAHISPICIILGTSKRELVDSIEWFVATGWG--ETRTHRTRGVLQITQLQRYNSSQCMQALGR- 207
            :..:|.|||:...:::.:|...::.:|| |||  ||.|..|. |.::|.|...:.:.|...|.. 
  Fly   383 YTDYIVPICLWSTSNRMDLPQGLKSYVA-GWGPDETGTGNTE-VSKVTDLNIVSEANCALELPHV 445

  Fly   208 LVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYG-------SRECSGIGVYTD 265
            |||.:.:||.:.|:..|..|.||||.  :|..|..  |..||:|.|       :.|.|...|:||
  Fly   446 LVQPSSLCAKKTGAGPCASDGGGPLM--LREQDVW--VLRGVISGGVINEKENTCELSKPSVFTD 506

  Fly   266 VYSYADWI 273
            |..:.:|:
  Fly   507 VAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 78/256 (30%)
Tryp_SPc 40..276 CDD:238113 79/257 (31%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 78/254 (31%)
Tryp_SPc 277..514 CDD:214473 77/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.