DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG8870

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:282 Identity:92/282 - (32%)
Similarity:129/282 - (45%) Gaps:48/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGLTANTIAFKIIGGRDAIINSNPWMAYI------HSSVKLI--CGGTLITQRFVLTAAHCV--- 82
            ||.:..    |...|:...:|..||||.:      :.|.||:  |||:||...:||||||||   
  Fly    77 CGQSRR----KPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYP 137

  Fly    83 --NEGSAVK-VRLGEYDDTATED----CNSKICIPRAEEHDVDMAFRHGKFSEIKNL-NDIALLR 139
              :...|:| |||||::.:...|    ...:...|...|.:||....|.:|:..:.| |||||:|
  Fly   138 FMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVR 202

  Fly   140 LAKFVTFKAHISPICI----ILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQ 200
            |...|.:...|.|||:    .|...||:       |.|:||.:........||..:.:...:...
  Fly   203 LKFPVRYTRAIQPICLPRAQKLAAHKRK-------FQASGWPDMGQGIASEVLLRSFIAERHPDV 260

  Fly   201 CMQ----ALGRLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSREC--- 257
            |..    .||     :|||||.| |:||..|||||||.:||...........|::|||.:.|   
  Fly   261 CKSNYDFNLG-----SQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLK 320

  Fly   258 -SGIGVYTDVYSYADWIATVVQ 278
             .....||....:.:||.:.:|
  Fly   321 TCKPAFYTKTSYFFEWIKSKLQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 87/265 (33%)
Tryp_SPc 40..276 CDD:238113 88/267 (33%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 87/258 (34%)
Tryp_SPc 93..337 CDD:214473 85/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.